Recombinant NPC2 Antibody — image 1 of 2

Product details

Recombinant NPC2 Antibody

Catalog number RC-5291-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-5291-01

Size / count 50 μL

Specifications

Catalog number: RC-5291-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: NPC intracellular cholesterol transporter 2, Epididymal secretory protein E1, Human epididymis-specific protein 1, He1, Niemann-Pick disease type C2 protein
Gene Name: NPC2
Gene ID: 10577
UniProt: P61916
Antigen Species: Human
Reactivity: Human, Rat, Mouse
Cross Reactivity: Not tested
Immunogen: Recombinant protein of human Niemann Pick C2
Partner Proteins: NPC intracellular cholesterol transporter 2; Epididymal secretory protein E1; Human epididymis-specific protein 1; He1; Niemann-Pick disease type C2 protein
Clone: K01_1U79
Conjugation: Unconjugated
Applications: IHC&WB
Validation: IHC&WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 82%, Pig - 85%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: EPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 82%
Recombinant Antibody: Yes
IHC Dilution: 1:50~1:100
WB Dilution: 1:1000
Formulation: 50mM Tris-Glycine (pH 7.4),0.15M NaCl,40% Glycerol,0.01% Sodium azide and 0.05% BSA
Antibody Type: Monoclonal
Gene Name Synonym: HE1
Target Alternative Name: NPC2
Panel Description: Neurodegenerative Diseases Marker
Host or Source: Rabbit
Protein Name: NPC intracellular cholesterol transporter 2
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant NPC2 Antibody?

The catalog number for Recombinant NPC2 Antibody is RC-5291.

What sizes are available for Recombinant NPC2 Antibody?

Recombinant NPC2 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant NPC2 Antibody come in?

Recombinant NPC2 Antibody is available in 3 different pack sizes.

Is Recombinant NPC2 Antibody in stock?

Recombinant NPC2 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

Is this product covered by a money-back guarantee?

Yes, we guarantee a full refund or store credit if this product arrives damaged beyond usability, or has a genuine performance issue under proper usage and storage, provided you report it immediately with evidence. Claims after the expiration date or due to improper storage after receipt are excluded.

All Products