Recombinant ENO2 Antibody

Catalog number RC-4534-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-4534-01

Size / count 50 μL

Specifications

Catalog number: RC-4534-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Gamma-enolase, 2-phospho-D-glycerate hydro-lyase, Enolase 2, Neural enolase, Neuron-specific enolase, NSE
Gene Name: ENO2
Gene ID: 2026
UniProt: P09104
Antigen Species: Human
Reactivity: Human, Mouse, Rat
Cross Reactivity: Not tested
Immunogen: Recombinant protein of human NSE
Partner Proteins: Gamma-enolase; 2-phospho-D-glycerate hydro-lyase; Enolase 2; Neural enolase; Neuron-specific enolase; NSE
Clone: K01_1U92
Conjugation: Unconjugated
Applications: WB
Validation: WB
Purity: ≥85%
Cores: EGGFAPNILENSEALELVKEAIDKAGYTEKIVIGMDVAASEFYRDGKYDLDFKSPTDPSRYITGDQLGALYQDFVRDYPVVSIEDPFDQDDWAAWSKFTANVGIQ
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Recombinant Antibody: Yes
WB Dilution: 1:500~1:1000
Formulation: 50mM Tris-Glycine (pH 7.4),0.15M NaCl,40% Glycerol,0.01% Sodium azide and 0.05% BSA
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: ENO2
Panel Description: IHC Pathology, Neurodegenerative Diseases Marker, Neuroscience Biomarkers
Host or Source: Rabbit
Protein Name: Enolase 2
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant ENO2 Antibody?

The catalog number for Recombinant ENO2 Antibody is RC-4534.

What sizes are available for Recombinant ENO2 Antibody?

Recombinant ENO2 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant ENO2 Antibody come in?

Recombinant ENO2 Antibody is available in 3 different pack sizes.

Is Recombinant ENO2 Antibody in stock?

Recombinant ENO2 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.