Recombinant CDKN2C Antibody — image 1 of 2

Product details

Recombinant CDKN2C Antibody

Catalog number RC-4591-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-4591-01

Size / count 50 μL

Specifications

Catalog number: RC-4591-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Cyclin-dependent kinase 4 inhibitor C, Cyclin-dependent kinase 6 inhibitor, p18-INK4c, p18-INK6
Gene Name: CDKN2C
Gene ID: 1031
UniProt: P42773
Antigen Species: Human
Reactivity: Human, Rat, Mouse
Cross Reactivity: Not tested
Immunogen: Recombinant protein of human p18 INK4c
Partner Proteins: Cyclin-dependent kinase 4 inhibitor C; Cyclin-dependent kinase 6 inhibitor; p18-INK4c; p18-INK6
Clone: K01_1W15
Conjugation: Unconjugated
Applications: IHC&WB
Validation: IHC&WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 96%, Rat - 45%, Pig - 100%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: EPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGN
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 96%
Recombinant Antibody: Yes
IHC Dilution: 1:50~1:100
WB Dilution: 1:1000
Formulation: 50mM Tris-Glycine (pH 7.4),0.15M NaCl,40% Glycerol,0.01% Sodium azide and 0.05% BSA
Antibody Type: Monoclonal
Gene Name Synonym: CDKN6
Target Alternative Name: CDKN2C
Host or Source: Rabbit
Protein Name: Cyclin dependent kinase inhibitor 2C
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant CDKN2C Antibody?

The catalog number for Recombinant CDKN2C Antibody is RC-4591.

What sizes are available for Recombinant CDKN2C Antibody?

Recombinant CDKN2C Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant CDKN2C Antibody come in?

Recombinant CDKN2C Antibody is available in 3 different pack sizes.

Is Recombinant CDKN2C Antibody in stock?

Recombinant CDKN2C Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What expression system was used for this recombinant protein?

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.

Can I return this product if I ordered the wrong one?

As a consumer, you have a 14-day right of withdrawal from receipt under EU consumer protection law, submitted via our withdrawal/cancellation request form. Note this applies to unused, undamaged products, and doesn’t override the expiry/storage conditions on performance-based claims.

Is this product tested for endotoxin levels?

Endotoxin testing status is noted on the datasheet where applicable, particularly for recombinant proteins intended for cell-based or functional assays. If this isn’t listed and you need confirmation, contact support with the catalogue number.