Recombinant PKC-gamma Antibody — image 1 of 2

Product details

Recombinant PKC-gamma Antibody

Catalog number RC-4935-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-4935-01

Size / count 50 μL

Specifications

Catalog number: RC-4935-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Protein kinase C gamma type, PKC-gamma
Gene Name: PRKCG
Gene ID: 5582
UniProt: P05129
Antigen Species: Human
Reactivity: Human, Rat
Cross Reactivity: Not tested
Immunogen: Recombinant protein of human PKC
Partner Proteins: Protein kinase C gamma type; PKC-gamma
Clone: K01_1W86
Conjugation: Unconjugated
Applications: WB
Validation: WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 99%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: DNVMLDAEGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWSFGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKRLGSGPDGEPTIRAHGFFRWIDWERLERLEIPPPFRPRPCGRSGENFDKFFTRAAPALTPPDRLVLASIDQADFQGFTYVNPDFVHP
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 99%
Recombinant Antibody: Yes
WB Dilution: 1:500~1:1000
Formulation: 50mM Tris-Glycine (pH 7.4),0.15M NaCl,40% Glycerol,0.01% Sodium azide and 0.05% BSA
Antibody Type: Monoclonal
Gene Name Synonym: PKCG
Target Alternative Name: PKC-gamma
Panel Description: Neurodegenerative Diseases Marker, Ferroptosis
Host or Source: Rabbit
Protein Name: Protein kinase C gamma
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant PKC-gamma Antibody?

The catalog number for Recombinant PKC-gamma Antibody is RC-4935.

What sizes are available for Recombinant PKC-gamma Antibody?

Recombinant PKC-gamma Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant PKC-gamma Antibody come in?

Recombinant PKC-gamma Antibody is available in 3 different pack sizes.

Is Recombinant PKC-gamma Antibody in stock?

Recombinant PKC-gamma Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product tested for endotoxin levels?

Endotoxin testing status is noted on the datasheet where applicable, particularly for recombinant proteins intended for cell-based or functional assays. If this isn’t listed and you need confirmation, contact support with the catalogue number.

Can I request additional validation data, such as western blot images, for this product?

Additional data may be available on request. Contact our technical support team with the catalogue number and we’ll check what supporting documentation the supplier can provide.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

All Products