Recombinant PRSS8 Antibody

Catalog number RC-4641-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-4641-01

Size / count 50 μL

Specifications

Catalog number: RC-4641-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Prostasin, Channel-activating protease 1, CAP1, Serine protease 8) [Cleaved into: Prostasin light chain, Prostasin heavy chain]
Gene Name: PRSS8
Gene ID: 5652
UniProt: Q16651
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant protein of human PRSS8
Partner Proteins: Prostasin; Channel-activating protease 1; CAP1; Serine protease 8) [Cleaved into: Prostasin light chain; Prostasin heavy chain]
Clone: K01_1X24
Conjugation: Unconjugated
Applications: WB
Validation: WB
Purity: ≥85%
Cores: TCNCLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASWIQSKVTELQPRVVPQTQESQPDSNLCGSHL
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Recombinant Antibody: Yes
WB Dilution: 1:500~1:1000
Formulation: 50mM Tris-Glycine (pH 7.4),0.15M NaCl,40% Glycerol,0.01% Sodium azide and 0.05% BSA
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: PRSS8
Host or Source: Rabbit
Protein Name: Serine protease 8
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant PRSS8 Antibody?

The catalog number for Recombinant PRSS8 Antibody is RC-4641.

What sizes are available for Recombinant PRSS8 Antibody?

Recombinant PRSS8 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant PRSS8 Antibody come in?

Recombinant PRSS8 Antibody is available in 3 different pack sizes.

Is Recombinant PRSS8 Antibody in stock?

Recombinant PRSS8 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What should I do if I need to report a performance issue with a specific lot of this product?

Provide the catalogue number, product name, lot number, and your experimental results to our technical support team. They’ll investigate and, if needed, escalate to the manufacturer, provided the product was used before expiry and stored correctly.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

All Products