Recombinant RAVER2 Antibody — image 1 of 2

Product details

Recombinant RAVER2 Antibody

Catalog number RC-5022-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-5022-01

Size / count 50 μL

Specifications

Catalog number: RC-5022-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Ribonucleoprotein PTB-binding 2, Protein raver-2
Gene Name: RAVER2
Gene ID: 55225
UniProt: Q9HCJ3
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant protein of human RAVER2
Partner Proteins: Ribonucleoprotein PTB-binding 2; Protein raver-2
Clone: K01_1X64
Conjugation: Unconjugated
Applications: IHC&WB&ICC/IF
Validation: IHC&WB&ICC/IF
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 75%, Pig - 86%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: PNQHIAGQAGPGHSNTQEKQPATVGMAEGNFSGSQPYLQSFPNLAAGSLLVGHHKQQQSQPKGTEISSGAASKNQTSLLGEPPKEIRLSKNPYLNLASVLPSVCLSSPASKTTLHKTGIASSILDAISQGSESQHALEKCIAYSPPFGDYAQVSSLRNEKRGSSYLISAPEGGSVECVDQHSQGTGAYYMETYLKKKR
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 75%
Recombinant Antibody: Yes
IHC Dilution: 1:500
WB Dilution: 1:1000
Formulation: 50mM Tris-Glycine (pH 7.4),0.15M NaCl,40% Glycerol,0.01% Sodium azide and 0.05% BSA
Antibody Type: Monoclonal
Gene Name Synonym: KIAA1579
Target Alternative Name: RAVER2
Host or Source: Rabbit
Protein Name: Ribonucleoprotein, PTB binding 2
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant RAVER2 Antibody?

The catalog number for Recombinant RAVER2 Antibody is RC-5022.

What sizes are available for Recombinant RAVER2 Antibody?

Recombinant RAVER2 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant RAVER2 Antibody come in?

Recombinant RAVER2 Antibody is available in 3 different pack sizes.

Is Recombinant RAVER2 Antibody in stock?

Recombinant RAVER2 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.

Does this product need any special customs documentation to be imported to my country?

If you’re outside the EU, UK, or USA, you’re responsible for customs clearance and any related taxes or fees. We provide the standard import documents, such as the Commercial Invoice, Packing List, and Airway Bill, in advance, so let us know early if your customs office needs anything additional for this specific product.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

All Products