Recombinant SEC61A Antibody — image 1 of 3

Product details

Recombinant SEC61A Antibody

Catalog number RC-4706-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-4706-01

Size / count 50 μL

Specifications

Catalog number: RC-4706-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Protein transport protein Sec61 subunit alpha isoform 2, Sec61 alpha-2
Gene Name: SEC61A2
Gene ID: 55176
UniProt: Q9H9S3
Antigen Species: Human
Reactivity: Human, Mouse, Rat
Cross Reactivity: Not tested
Immunogen: Recombinant protein of human SEC61A
Partner Proteins: Protein transport protein Sec61 subunit alpha isoform 2; Sec61 alpha-2
Clone: K01_1Y19
Conjugation: Unconjugated
Applications: IHC&WB&ICC/IF
Validation: IHC&WB&ICC/IF
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 100%, Rat - 98%, Pig - 100%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: SKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTA
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 100%
Recombinant Antibody: Yes
IHC Dilution: 1:50~1:100
WB Dilution: 1:500~1:1000
Formulation: 50mM Tris-Glycine (pH 7.4),0.15M NaCl,40% Glycerol,0.01% Sodium azide and 0.05% BSA
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: SEC61A
Panel Description: Ubiquitin-Proteasome System
Host or Source: Rabbit
Protein Name: SEC61 translocon subunit alpha 2
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant SEC61A Antibody?

The catalog number for Recombinant SEC61A Antibody is RC-4706.

What sizes are available for Recombinant SEC61A Antibody?

Recombinant SEC61A Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant SEC61A Antibody come in?

Recombinant SEC61A Antibody is available in 3 different pack sizes.

Is Recombinant SEC61A Antibody in stock?

Recombinant SEC61A Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

Can this product be used for co-immunoprecipitation (Co-IP)?

Suitability for Co-IP depends on the specific antibody and is noted under validated applications on the datasheet. If it isn’t listed, contact our technical support team for guidance based on your target and sample type.

Is this kit compatible with automated liquid handling platforms?

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.