Recombinant SLAMF6 Antibody

Catalog number RC-4808-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-4808-01

Size / count 50 μL

Specifications

Catalog number: RC-4808-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: SLAM family member 6, Activating NK receptor, NK-T-B-antigen, NTB-A, CD antigen CD352
Gene Name: SLAMF6
Gene ID: 114836
UniProt: Q96DU3
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant protein of human SLAMF6
Target Antigen: CD352
Partner Proteins: SLAM family member 6; Activating NK receptor; NK-T-B-antigen; NTB-A; CD antigen CD352
Clone: K01_1Y45
Conjugation: Unconjugated
Applications: WB
Validation: WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 48%, Rat - 27%, Pig - 60%, Cynomolgus monkey - 82%
Purity: ≥85%
Cores: SLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 48%
Recombinant Antibody: Yes
WB Dilution: 1:500~1:1000
Formulation: 50mM Tris-Glycine (pH 7.4),0.15M NaCl,40% Glycerol,0.01% Sodium azide and 0.05% BSA
Antibody Type: Monoclonal
Gene Name Synonym: KALI
Target Alternative Name: SLAMF6
Panel Description: CD Antigen
Host or Source: Rabbit
Protein Name: SLAM family member 6
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant SLAMF6 Antibody?

The catalog number for Recombinant SLAMF6 Antibody is RC-4808.

What sizes are available for Recombinant SLAMF6 Antibody?

Recombinant SLAMF6 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant SLAMF6 Antibody come in?

Recombinant SLAMF6 Antibody is available in 3 different pack sizes.

Is Recombinant SLAMF6 Antibody in stock?

Recombinant SLAMF6 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What happens if this product doesn’t perform as expected in my experiment?

Send us the catalogue number, product name, lot number, and a summary of your results. Our technical support team will investigate and, where needed, involve the manufacturer. This is covered under our guarantee provided the product was used before its expiry date and stored correctly.

Is this product classed as hazardous or restricted for shipping?

Some products are subject to special import/export regulations, dangerous goods handling, or licensing requirements. Where this applies, it’s noted on the product page, and any required extra documents or fees will be confirmed with you before dispatch, never added without your consent.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

All Products