Recombinant STAT5A Antibody — image 1 of 3

Product details

Recombinant STAT5A Antibody

Catalog number RC-4528-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-4528-01

Size / count 50 μL

Specifications

Catalog number: RC-4528-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Signal transducer and activator of transcription 5A
Gene Name: STAT5A
Gene ID: 6776
UniProt: P42229
Antigen Species: Human
Reactivity: Human, Mouse, Rat
Cross Reactivity: Not tested
Immunogen: Recombinant protein of mouse STAT5A
Partner Proteins: Signal transducer and activator of transcription 5A
Clone: K01_1Y78
Conjugation: Unconjugated
Applications: IP/ChIP&WB&ICC/IF
Validation: IP/ChIP&WB&ICC/IF
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 93%, Rat - 94%, Pig - 94%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: KQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPERNLWNLKPFTTRDFSIRSLADRLGDLSYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFVNASADAGGSSATYMDQAPSPAVCPQAPYNMYPQNPDHVLDQDGEFDLDETMDVARHVEELLRRPMDSLDSRLSPPAGLF
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 93%
Recombinant Antibody: Yes
WB Dilution: 1:1000
IP Dilution: 1:1000
Formulation: 50mM Tris-Glycine (pH 7.4),0.15M NaCl,40% Glycerol,0.01% Sodium azide and 0.05% BSA
Antibody Type: Monoclonal
Gene Name Synonym: STAT5
Target Alternative Name: STAT5A
Panel Description: Transcription Factors
Host or Source: Rabbit
Protein Name: Signal transducer and activator of transcription 5A
WB Description: Succeed
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant STAT5A Antibody?

The catalog number for Recombinant STAT5A Antibody is RC-4528.

What sizes are available for Recombinant STAT5A Antibody?

Recombinant STAT5A Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant STAT5A Antibody come in?

Recombinant STAT5A Antibody is available in 3 different pack sizes.

Is Recombinant STAT5A Antibody in stock?

Recombinant STAT5A Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.

Can this product be used in multiplex assays?

Multiplex compatibility depends on the specific product and detection panel. Contact our technical support team with details of your multiplex system for guidance before ordering.

All Products