Recombinant UQCRB Antibody — image 1 of 3

Product details

Recombinant UQCRB Antibody

Catalog number RC-5465-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-5465-01

Size / count 50 μL

Specifications

Catalog number: RC-5465-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Cytochrome b-c1 complex subunit 7, Complex III subunit 7, Complex III subunit VII, QP-C, Ubiquinol-cytochrome c reductase complex 14 kDa protein
Gene Name: UQCRB
Gene ID: 7381
UniProt: P14927
Antigen Species: Human
Reactivity: Human, Mouse, Rat
Cross Reactivity: Not tested
Immunogen: Recombinant protein of human UQCRB
Partner Proteins: Cytochrome b-c1 complex subunit 7; Complex III subunit 7; Complex III subunit VII; QP-C; Ubiquinol-cytochrome c reductase complex 14 kDa protein
Clone: K01_2J85
Conjugation: Unconjugated
Applications: IHC&WB
Validation: IHC&WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 86%, Pig - 87%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: AGKQAVSASGKWLDGIRKWYYNAAGFNKLGLMRDDTIYEDEDVKEAIRRLPENLYNDRMFRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 86%
Recombinant Antibody: Yes
IHC Dilution: 1:100
WB Dilution: 1:1000
Formulation: 50mM Tris-Glycine (pH 7.4),0.15M NaCl,40% Glycerol,0.01% Sodium azide and 0.05% BSA
Antibody Type: Monoclonal
Gene Name Synonym: UQBP
Target Alternative Name: UQCRB
Host or Source: Rabbit
Protein Name: Ubiquinol-cytochrome c reductase binding protein
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant UQCRB Antibody?

The catalog number for Recombinant UQCRB Antibody is RC-5465.

What sizes are available for Recombinant UQCRB Antibody?

Recombinant UQCRB Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant UQCRB Antibody come in?

Recombinant UQCRB Antibody is available in 3 different pack sizes.

Is Recombinant UQCRB Antibody in stock?

Recombinant UQCRB Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

All Products