Recombinant WASF1 Antibody

Catalog number RC-5489-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-5489-01

Size / count 50 μL

Specifications

Catalog number: RC-5489-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Actin-binding protein WASF1, Protein WAVE-1, Verprolin homology domain-containing protein 1, Wiskott-Aldrich syndrome protein family member 1, WASP family protein member 1
Gene Name: WASF1
Gene ID: 8936
UniProt: Q92558
Antigen Species: Human
Reactivity: Human, Mouse, Rat
Cross Reactivity: Not tested
Immunogen: Recombinant protein of human WAVE 1
Partner Proteins: Actin-binding protein WASF1; Protein WAVE-1; Verprolin homology domain-containing protein 1; Wiskott-Aldrich syndrome protein family member 1; WASP family protein member 1
Clone: K01_2K10
Conjugation: Unconjugated
Applications: WB
Validation: WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 100%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: MPLVKRNIDPRHLCHTALPRGIKNELECVTNISLANIIRQLSSLSKYAEDIFGELFNEAHSFSFRVNSLQERVDRLSVSVTQLDPKEEELSLQDITMRKA
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 100%
Recombinant Antibody: Yes
WB Dilution: 1:500~1:1000
Formulation: 50mM Tris-Glycine (pH 7.4),0.15M NaCl,40% Glycerol,0.01% Sodium azide and 0.05% BSA
Antibody Type: Monoclonal
Gene Name Synonym: KIAA0269; SCAR1; WAVE1
Target Alternative Name: WASF1
Host or Source: Rabbit
Protein Name: WASP family member 1
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant WASF1 Antibody?

The catalog number for Recombinant WASF1 Antibody is RC-5489.

What sizes are available for Recombinant WASF1 Antibody?

Recombinant WASF1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant WASF1 Antibody come in?

Recombinant WASF1 Antibody is available in 3 different pack sizes.

Is Recombinant WASF1 Antibody in stock?

Recombinant WASF1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

All Products