Recombinant NDUFB1 Antibody

Catalog number RC-5529-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-5529-01

Size / count 50 μL

Specifications

Catalog number: RC-5529-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1, Complex I-MNLL, CI-MNLL, NADH-ubiquinone oxidoreductase MNLL subunit
Gene Name: NDUFB1
Gene ID: 4707
UniProt: O75438
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant protein of human NDUFB1
Partner Proteins: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1; Complex I-MNLL; CI-MNLL; NADH-ubiquinone oxidoreductase MNLL subunit
Clone: K01_2K51
Conjugation: Unconjugated
Applications: IHC&WB
Validation: IHC&WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 75%, Rat - 77%, Pig - 83%, Cynomolgus monkey - 93%
Purity: ≥85%
Cores: MVNLLQIVRDHWVHVLVPMGFVIGCYLDRKSDERLTAFRNKSMLFKRELQPSEEVTWK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 75%
Recombinant Antibody: Yes
IHC Dilution: 1:100
WB Dilution: 1:1000
Formulation: 50mM Tris-Glycine (pH 7.4),0.15M NaCl,40% Glycerol,0.01% Sodium azide and 0.05% BSA
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: NDUFB1
Host or Source: Rabbit
Protein Name: NADH:ubiquinone oxidoreductase subunit B1
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant NDUFB1 Antibody?

The catalog number for Recombinant NDUFB1 Antibody is RC-5529.

What sizes are available for Recombinant NDUFB1 Antibody?

Recombinant NDUFB1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant NDUFB1 Antibody come in?

Recombinant NDUFB1 Antibody is available in 3 different pack sizes.

Is Recombinant NDUFB1 Antibody in stock?

Recombinant NDUFB1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product species cross-reactive?

Cross-reactivity data, based on available testing, is listed under the reactivity section of the datasheet. Contact us if you need reactivity confirmed for a species not listed.

Is there an additional fee for hazardous or dry ice shipping of this product?

Yes, if this product requires dry ice or is classed as hazardous for transport, the additional fee will be explicitly shown in your quotation before you confirm the order, so there are no surprise charges later.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

All Products