Recombinant ATF6 Antibody

Catalog number RC-5621-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-5621-01

Size / count 50 μL

Specifications

Catalog number: RC-5621-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Cyclic AMP-dependent transcription factor ATF-6 alpha, cAMP-dependent transcription factor ATF-6 alpha, Activating transcription factor 6 alpha, ATF6-alpha) [Cleaved into: Processed cyclic AMP-dependent transcription factor ATF-6 alpha]
Gene Name: ATF6
Gene ID: 22926
UniProt: P18850
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant protein of human ATF6
Partner Proteins: Cyclic AMP-dependent transcription factor ATF-6 alpha; cAMP-dependent transcription factor ATF-6 alpha; Activating transcription factor 6 alpha; ATF6-alpha) [Cleaved into: Processed cyclic AMP-dependent transcription factor ATF-6 alpha]
Clone: K01_2L46
Conjugation: Unconjugated
Applications: IHC&WB
Validation: IHC&WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 80%, Rat - 82%, Pig - 89%, Cynomolgus monkey - 97%
Purity: ≥85%
Cores: MGEPAGVAGTMESPFSPGLFHRLDEDWDSALFAELGYFTDTDELQLEAANETYENNFDNLDFDLDLMPWESDIWDINNQICTVKDIKAEPQPLSPASSSYSVSSPRSVDSYSSTQHVPEELDLSSSSQMSPLSLYGENSNSLSSAEPLKEDKPVTGPRNKTENGLTPKKKIQVNSKPSIQPKPLLLPAAPKTQTNSSVPAKTIIIQTVPTLMPLAKQQPIISLQPAPTKGQTVLLSQPTVVQLQAPGVLPSAQPVLAVAGGVTQLPNHVVNVVPAPSANSPVNGKLSVTKPVLQSTMRNVGSDIAVLRRQQRMIKNRESACQSRKKKKEYMLG
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 80%
Recombinant Antibody: Yes
IHC Dilution: 1:50~1:100
WB Dilution: 1:1000
Formulation: 50mM Tris-Glycine (pH 7.4),0.15M NaCl,40% Glycerol,0.01% Sodium azide and 0.05% BSA
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: ATF6
Panel Description: Ferroptosis, Transcription Factors
Host or Source: Rabbit
Protein Name: Activating transcription factor 6
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant ATF6 Antibody?

The catalog number for Recombinant ATF6 Antibody is RC-5621.

What sizes are available for Recombinant ATF6 Antibody?

Recombinant ATF6 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant ATF6 Antibody come in?

Recombinant ATF6 Antibody is available in 3 different pack sizes.

Is Recombinant ATF6 Antibody in stock?

Recombinant ATF6 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.

All Products