Recombinant DGKA Antibody — image 1 of 2

Product details

Recombinant DGKA Antibody

Catalog number RC-5684-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-5684-01

Size / count 50 μL

Specifications

Catalog number: RC-5684-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Diacylglycerol kinase alpha, DAG kinase alpha, 80 kDa diacylglycerol kinase, Diglyceride kinase alpha, DGK-alpha
Gene Name: DGKA
Gene ID: 1606
UniProt: P23743
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant protein of human DGKA
Partner Proteins: Diacylglycerol kinase alpha; DAG kinase alpha; 80 kDa diacylglycerol kinase; Diglyceride kinase alpha; DGK-alpha
Clone: K01_2M11
Conjugation: Unconjugated
Applications: IHC&WB
Validation: IHC&WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 90%, Rat - 89%, Pig - 97%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: EKSDPVPFQIINNYFSIGVDASIAHRFHIMREKYPEKFNSRMKNKLWYFEFATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIAVLNIPSMHGGSNLWGDTRRPHGDIYGINQALGATAKVITDPDILKTCVPDLSDKRLEVVGLEGAIEMGQIYTKLKNAGRRLAKCSEITFHTTKTLPMQIDGE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 90%
Recombinant Antibody: Yes
IHC Dilution: 1:50~1:100
WB Dilution: 1:500~1:1000
Formulation: 50mM Tris-Glycine (pH 7.4),0.15M NaCl,40% Glycerol,0.01% Sodium azide and 0.05% BSA
Antibody Type: Monoclonal
Gene Name Synonym: DAGK; DAGK1
Target Alternative Name: DGKA
Host or Source: Rabbit
Protein Name: Diacylglycerol kinase alpha
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant DGKA Antibody?

The catalog number for Recombinant DGKA Antibody is RC-5684.

What sizes are available for Recombinant DGKA Antibody?

Recombinant DGKA Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant DGKA Antibody come in?

Recombinant DGKA Antibody is available in 3 different pack sizes.

Is Recombinant DGKA Antibody in stock?

Recombinant DGKA Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

All Products