Recombinant TUBG1 Antibody — image 1 of 3

Product details

Recombinant TUBG1 Antibody

Catalog number RC-5722-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-5722-01

Size / count 50 μL

Specifications

Catalog number: RC-5722-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Tubulin gamma-1 chain, Gamma-1-tubulin, Gamma-tubulin complex component 1, GCP-1
Gene Name: TUBG1
Gene ID: 7283
UniProt: P23258
Antigen Species: Human
Reactivity: Human, Mouse, Rat, Hamster
Cross Reactivity: Not tested
Immunogen: Recombinant protein of human gamma Tubulin
Partner Proteins: Tubulin gamma-1 chain; Gamma-1-tubulin; Gamma-tubulin complex component 1; GCP-1
Clone: K01_2M49
Conjugation: Unconjugated
Applications: IHC&WB&ICC/IF
Validation: IHC&WB&ICC/IF
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 99%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: LVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDEMDTSREIVQQLIDEYHAATRPDYISWGTQEQ
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 99%
Recombinant Antibody: Yes
IHC Dilution: 1:500
WB Dilution: 1:1000
Formulation: 50mM Tris-Glycine (pH 7.4),0.15M NaCl,40% Glycerol,0.01% Sodium azide and 0.05% BSA
Antibody Type: Monoclonal
Gene Name Synonym: TUBG
Target Alternative Name: TUBG1
Host or Source: Rabbit
Protein Name: Tubulin gamma 1
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant TUBG1 Antibody?

The catalog number for Recombinant TUBG1 Antibody is RC-5722.

What sizes are available for Recombinant TUBG1 Antibody?

Recombinant TUBG1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant TUBG1 Antibody come in?

Recombinant TUBG1 Antibody is available in 3 different pack sizes.

Is Recombinant TUBG1 Antibody in stock?

Recombinant TUBG1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.

All Products