Recombinant NPC2 Antibody — image 1 of 3

Product details

Recombinant NPC2 Antibody

Catalog number RC-5827-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-5827-01

Size / count 50 μL

Specifications

Catalog number: RC-5827-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: NPC intracellular cholesterol transporter 2, Epididymal secretory protein E1, Human epididymis-specific protein 1, He1, Niemann-Pick disease type C2 protein
Gene Name: NPC2
Gene ID: 10577
UniProt: P61916
Antigen Species: Human
Reactivity: Human, Rat, Mouse
Cross Reactivity: Not tested
Immunogen: Recombinant protein of human Niemann Pick C2
Partner Proteins: NPC intracellular cholesterol transporter 2; Epididymal secretory protein E1; Human epididymis-specific protein 1; He1; Niemann-Pick disease type C2 protein
Clone: K01_2N55
Conjugation: Unconjugated
Applications: IHC&WB&ICC/IF
Validation: IHC&WB&ICC/IF
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 82%, Pig - 85%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: EPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 82%
Recombinant Antibody: Yes
IHC Dilution: 1:50~1:100
WB Dilution: 1:1000
Formulation: 50mM Tris-Glycine (pH 7.4),0.15M NaCl,40% Glycerol,0.01% Sodium azide and 0.05% BSA
Antibody Type: Monoclonal
Gene Name Synonym: HE1
Target Alternative Name: NPC2
Panel Description: Neurodegenerative Diseases Marker
Host or Source: Rabbit
Protein Name: NPC intracellular cholesterol transporter 2
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant NPC2 Antibody?

The catalog number for Recombinant NPC2 Antibody is RC-5827.

What sizes are available for Recombinant NPC2 Antibody?

Recombinant NPC2 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant NPC2 Antibody come in?

Recombinant NPC2 Antibody is available in 3 different pack sizes.

Is Recombinant NPC2 Antibody in stock?

Recombinant NPC2 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product classed as hazardous or restricted for shipping?

Some products are subject to special import/export regulations, dangerous goods handling, or licensing requirements. Where this applies, it’s noted on the product page, and any required extra documents or fees will be confirmed with you before dispatch, never added without your consent.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

All Products