Recombinant PKC-beta 1 Antibody — image 1 of 3

Product details

Recombinant PKC-beta 1 Antibody

Catalog number RC-5979-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-5979-01

Size / count 50 μL

Specifications

Catalog number: RC-5979-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Protein kinase C beta type, PKC-B, PKC-beta
Gene Name: PRKCB
Gene ID: 5579
UniProt: P05771
Antigen Species: Human
Reactivity: Human, Rat, Mouse
Cross Reactivity: Not tested
Immunogen: A synthesized peptide derived from human PKC beta 2
Partner Proteins: Protein kinase C beta type; PKC-B; PKC-beta
Clone: K01_2Q09
Conjugation: Unconjugated
Applications: IHC&WB&ICC/IF
Validation: IHC&WB&ICC/IF
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 96%, Rat - 96%, Pig - 96%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: RDVLIVLVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSEANEELRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTDFNFLMVLGK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 96%
Recombinant Antibody: Yes
IHC Dilution: 1:50~1:100
WB Dilution: 1:1000
Formulation: 50mM Tris-Glycine (pH 7.4),0.15M NaCl,40% Glycerol,0.01% Sodium azide and 0.05% BSA
Antibody Type: Monoclonal
Gene Name Synonym: PKCB; PRKCB1
Target Alternative Name: PKC-beta 1
Panel Description: DNA binding & Chromatin, Ferroptosis
Host or Source: Rabbit
Protein Name: Protein kinase C beta
WB Description: Succeed
IHC description: Succeed
IP description: Fail (K-562)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant PKC-beta 1 Antibody?

The catalog number for Recombinant PKC-beta 1 Antibody is RC-5979.

What sizes are available for Recombinant PKC-beta 1 Antibody?

Recombinant PKC-beta 1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant PKC-beta 1 Antibody come in?

Recombinant PKC-beta 1 Antibody is available in 3 different pack sizes.

Is Recombinant PKC-beta 1 Antibody in stock?

Recombinant PKC-beta 1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What should I check when this product first arrives?

Inspect the package immediately for transportation damage, ice loss, leakage, or breakage. Report any issues right away with photos and your order reference; our specialists will determine whether the product is still usable or needs replacing.

Does this cell line or biologic require a Material Transfer Agreement (MTA)?

Some products, including certain cell lines, plasmids, and tissue cultures, are subject to intellectual property terms and may require an MTA before we can ship. We’ll inform you in advance if this product requires one, and additional handling fees may apply.

What should I do if I need to report a performance issue with a specific lot of this product?

Provide the catalogue number, product name, lot number, and your experimental results to our technical support team. They’ll investigate and, if needed, escalate to the manufacturer, provided the product was used before expiry and stored correctly.

All Products