Recombinant COL3A1 Antibody — image 1 of 2

Product details

Recombinant COL3A1 Antibody

Catalog number RC-6003-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-6003-01

Size / count 50 μL

Specifications

Catalog number: RC-6003-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Collagen alpha-1 (III) chain
Gene Name: COL3A1
Gene ID: 1281
UniProt: P02461
Antigen Species: Human
Reactivity: Human, Rat, Mouse
Cross Reactivity: Not tested
Immunogen: Recombinant protein of human Collagen III
Partner Proteins: Collagen alpha-1 (III) chain
Clone: K01_2Q33
Conjugation: Unconjugated
Applications: IP/ChIP&WB&ICC/IF
Validation: IP/ChIP&WB&ICC/IF
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 97%, Rat - 98%, Pig - 95%, Cynomolgus monkey - 97%
Purity: ≥85%
Cores: GPPGEPGQAGPSGPPGPPGAIGPSGPAGKDGESGRPGRPGERGLPGPPGIKGPAGIPGFPGMKGHRGFDGRNGEKGETGAPGLKGENGLPGENGAPGPMGPRGAPGERGRPGLPGAAGARGNDGARGSDGQPGPPGPPGTAGFPGSPGAKGEVGPAGSPGSNGAPGQRGEPGPQGHAGAQGPPGPPGINGSPGGKGEMGP
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 97%
Recombinant Antibody: Yes
WB Dilution: 1:1000
IP Dilution: 1:1000
Formulation: 50mM Tris-Glycine (pH 7.4),0.15M NaCl,40% Glycerol,0.01% Sodium azide and 0.05% BSA
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: COL3A1
Host or Source: Rabbit
Protein Name: Collagen type III alpha 1 chain
WB Description: Succeed
IHC description: Fail (Gallbladder)
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant COL3A1 Antibody?

The catalog number for Recombinant COL3A1 Antibody is RC-6003.

What sizes are available for Recombinant COL3A1 Antibody?

Recombinant COL3A1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant COL3A1 Antibody come in?

Recombinant COL3A1 Antibody is available in 3 different pack sizes.

Is Recombinant COL3A1 Antibody in stock?

Recombinant COL3A1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

All Products