Carcino Embryonic Antigen CEA (CD66e) Antibody — image 1 of 3

Product details

Carcino Embryonic Antigen CEA (CD66e) Antibody

Catalog number KC-6053-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-6053-01

Size / count 50 μL

Specifications

Catalog number: KC-6053-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Carcinoembryonic antigen-related cell adhesion molecule 5, Carcinoembryonic antigen, CEA, Meconium antigen 100, CD antigen CD66e
Gene Name: CEACAM5
Gene ID: 1048
UniProt: P06731
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Synthetic Peptide of Carcinoembryonic Antigen
Target Antigen: CD66e
Partner Proteins: Carcinoembryonic antigen-related cell adhesion molecule 5; Carcinoembryonic antigen; CEA; Meconium antigen 100; CD antigen CD66e
Clone: K01_2Q83
Conjugation: Unconjugated
Applications: IHC&ICC/IF
Validation: IHC&ICC/IF
Purity: ≥85%
Cores: KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSA
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Recombinant Antibody: Not recombinant
IHC Dilution: 1:50~1:100
IF Dilution: 1:50~1:200
Formulation: Liquid in PBS containing 50% glycerol,0.5% BSA and 0.02% sodium azide, pH 7.3
Antibody Type: Monoclonal
Gene Name Synonym: CEA
Target Alternative Name: Carcino Embryonic Antigen CEA (CD66e)
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: CEA cell adhesion molecule 5
IHC description: Succeed
IF/ICC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Carcino Embryonic Antigen CEA (CD66e) Antibody?

The catalog number for Carcino Embryonic Antigen CEA (CD66e) Antibody is KC-6053.

What sizes are available for Carcino Embryonic Antigen CEA (CD66e) Antibody?

Carcino Embryonic Antigen CEA (CD66e) Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Carcino Embryonic Antigen CEA (CD66e) Antibody come in?

Carcino Embryonic Antigen CEA (CD66e) Antibody is available in 3 different pack sizes.

Is Carcino Embryonic Antigen CEA (CD66e) Antibody in stock?

Carcino Embryonic Antigen CEA (CD66e) Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What happens if this product doesn’t perform as expected in my experiment?

Send us the catalogue number, product name, lot number, and a summary of your results. Our technical support team will investigate and, where needed, involve the manufacturer. This is covered under our guarantee provided the product was used before its expiry date and stored correctly.

Is this product classed as hazardous or restricted for shipping?

Some products are subject to special import/export regulations, dangerous goods handling, or licensing requirements. Where this applies, it’s noted on the product page, and any required extra documents or fees will be confirmed with you before dispatch, never added without your consent.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.