Thioredoxin Reductase 2 Antibody

Catalog number KC-6123-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-6123-01

Size / count 50 μL

Specifications

Catalog number: KC-6123-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Thioredoxin reductase 2, mitochondrial, Selenoprotein Z, SelZ, TR-beta, Thioredoxin reductase TR3
Gene Name: TXNRD2
Gene ID: 10587
UniProt: Q9NNW7
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Purified recombinant human TXNRD2 protein fragments expressed in E.coli.
Partner Proteins: Thioredoxin reductase 2; mitochondrial; Selenoprotein Z; SelZ; TR-beta; Thioredoxin reductase TR3
Clone: K01_2R54
Conjugation: Unconjugated
Applications: WB
Validation: WB
Purity: ≥85%
Cores: MSSMVIEHMASHGTRFLRGCAPSRVRRLPDGQLQVTWEDSTTGKEDTGTFDTVLWAIGRVPDTRSLNLEKAGVDTSPDTQKILVDSREATSVPHIYAIGDVVEGRPELTPIAIMAGRLLVQRLFGGSSDLMDYD
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Recombinant Antibody: Not recombinant
WB Dilution: 1:500~1:1000
Formulation: Liquid in PBS containing 50% glycerol,0.5% BSA and 0.02% sodium azide, pH 7.3
Antibody Type: Monoclonal
Gene Name Synonym: KIAA1652; TRXR2
Target Alternative Name: Thioredoxin Reductase 2
Host or Source: Mouse
Protein Name: Thioredoxin reductase 2
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Thioredoxin Reductase 2 Antibody?

The catalog number for Thioredoxin Reductase 2 Antibody is KC-6123.

What sizes are available for Thioredoxin Reductase 2 Antibody?

Thioredoxin Reductase 2 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Thioredoxin Reductase 2 Antibody come in?

Thioredoxin Reductase 2 Antibody is available in 3 different pack sizes.

Is Thioredoxin Reductase 2 Antibody in stock?

Thioredoxin Reductase 2 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.

Can this product be used in multiplex assays?

Multiplex compatibility depends on the specific product and detection panel. Contact our technical support team with details of your multiplex system for guidance before ordering.

All Products