Product details

NF-KB p65 Antibody

Catalog number KC-6230-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-6230-01

Size / count 50 μL

Specifications

Catalog number: KC-6230-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Transcription factor p65, Nuclear factor NF-kappa-B p65 subunit, Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3
Gene Name: RELA
Gene ID: 5970
UniProt: Q04206
Antigen Species: Human
Reactivity: Human, Rat, Mouse
Cross Reactivity: Not tested
Immunogen: Recombinant Protein of Transcription factor p65
Partner Proteins: Transcription factor p65; Nuclear factor NF-kappa-B p65 subunit; Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3
Clone: K01_2S63
Conjugation: Unconjugated
Applications: IHC&IP/ChIP&WB&ICC/IF
Validation: IHC&IP/ChIP&WB&ICC/IF
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 100%, Rat - 51%, Pig - 100%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: QVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRH
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 100%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:50~1:100
WB Dilution: 1:1000
IP Dilution: 1:20
IF Dilution: 1:50~1:200
Formulation: Liquid in PBS containing 50% glycerol,0.5% BSA and 0.02% sodium azide, pH 7.3
Antibody Type: Monoclonal
Gene Name Synonym: NFKB3
Target Alternative Name: NF-KB p65
Panel Description: Ferroptosis, Transcription Factors
Host or Source: Mouse
Protein Name: RELA proto-oncogene, NF-kB subunit
WB Description: Succeed
IHC description: Succeed
IF/ICC description: Succeed
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for NF-KB p65 Antibody?

The catalog number for NF-KB p65 Antibody is KC-6230.

What sizes are available for NF-KB p65 Antibody?

NF-KB p65 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does NF-KB p65 Antibody come in?

NF-KB p65 Antibody is available in 3 different pack sizes.

Is NF-KB p65 Antibody in stock?

NF-KB p65 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this kit compatible with automated liquid handling platforms?

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.