Recombinant S6K2 Antibody — image 1 of 3

Product details

Recombinant S6K2 Antibody

Catalog number RC-6999-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-6999-01

Size / count 50 μL

Specifications

Catalog number: RC-6999-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Ribosomal protein S6 kinase beta-2, S6K-beta-2, S6K2, 70 kDa ribosomal protein S6 kinase 2, P70S6K2, p70-S6K 2, S6 kinase-related kinase, SRK, Serine/threonine-protein kinase 14B, p70 ribosomal S6 kinase beta, S6K-beta, p70 S6 kinase beta, p70 S6K-beta, p70 S6KB, p70-beta
Gene Name: RPS6KB2
Gene ID: 6199
UniProt: Q9UBS0
Antigen Species: Human
Reactivity: Human, Mouse, Rat
Cross Reactivity: Not tested
Immunogen: Recombinant protein of human P70 S6 Kinase beta
Partner Proteins: Ribosomal protein S6 kinase beta-2; S6K-beta-2; S6K2; 70 kDa ribosomal protein S6 kinase 2; P70S6K2; p70-S6K 2; S6 kinase-related kinase; SRK; Serine/threonine-protein kinase 14B; p70 ribosomal S6 kinase beta; S6K-beta; p70 S6 kinase beta; p70 S6K-beta; p70 S6KB; p70-beta
Clone: K01_3L54
Conjugation: Unconjugated
Applications: IHC&WB&ICC/IF
Validation: IHC&WB&ICC/IF
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 93%, Rat - 61%, Pig - 97%, Cynomolgus monkey - 94%
Purity: ≥85%
Cores: MAAVFDLDLETEEGSEGEGEPELSPADACPLAELRAAGLEPVGHYEEVELTETSVNVGPERIGPHCFELLRVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVRNAKDTAHTRAER
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 93%
Recombinant Antibody: Yes
IHC Dilution: 1:50~1:100
WB Dilution: 1:500~1:1000
Formulation: 50mM Tris-Glycine (pH 7.4),0.15M NaCl,40% Glycerol,0.01% Sodium azide and 0.05% BSA
Antibody Type: Monoclonal
Gene Name Synonym: STK14B
Target Alternative Name: S6K2
Host or Source: Rabbit
Protein Name: Ribosomal protein S6 kinase B2
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant S6K2 Antibody?

The catalog number for Recombinant S6K2 Antibody is RC-6999.

What sizes are available for Recombinant S6K2 Antibody?

Recombinant S6K2 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant S6K2 Antibody come in?

Recombinant S6K2 Antibody is available in 3 different pack sizes.

Is Recombinant S6K2 Antibody in stock?

Recombinant S6K2 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.