Recombinant NECAB2 Antibody

Catalog number RN-084-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-084-01

Size / count 50 μL

Specifications

Catalog number: RN-084-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: N-terminal EF-hand calcium-binding protein 2, EF-hand calcium-binding protein 2, Neuronal calcium-binding protein 2, Synaptotagmin-interacting protein 2, Stip-2
Gene Name: NECAB2
Gene ID: 54550
UniProt: Q7Z6G3
Antigen Species: Human
Reactivity: Human, Rat
Cross Reactivity: Not tested
Immunogen: Recombinant human NECAB2
Target: PP-7897
Partner Proteins: N-terminal EF-hand calcium-binding protein 2; EF-hand calcium-binding protein 2; Neuronal calcium-binding protein 2; Synaptotagmin-interacting protein 2; Stip-2
Clone: K8U020_8H5
Conjugation: Unconjugated
Applications: Top_IP/ChIP&Top_WB
Validation: Top_IP/ChIP&Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 95%, Rat - 95%, Pig - 96%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: GTAVILDIFRRADKNDDGKLSLEEFQLFFADGVLNEKELEDLFHTIDSDNTNHVDTKELCDYFVDHMGDYEDVLASLETLNHSVLKAMGYTKKVYEGGSNVDQFVTRFLLKETANQIQSLLSSVESAVEAIEEQTSQLRQ
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 95%
Recombinant Antibody: Yes
WB Dilution: 1:1000
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: EFCBP2
Target Alternative Name: NECAB2
Panel Description: Neuroscience Biomarkers
Host or Source: Mouse
Protein Name: N-terminal EF-hand calcium binding protein 2
WB Description: Succeed
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant NECAB2 Antibody?

The catalog number for Recombinant NECAB2 Antibody is RN-084.

What sizes are available for Recombinant NECAB2 Antibody?

Recombinant NECAB2 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant NECAB2 Antibody come in?

Recombinant NECAB2 Antibody is available in 3 different pack sizes.

Is Recombinant NECAB2 Antibody in stock?

Recombinant NECAB2 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product covered by a money-back guarantee?

Yes, we guarantee a full refund or store credit if this product arrives damaged beyond usability, or has a genuine performance issue under proper usage and storage, provided you report it immediately with evidence. Claims after the expiration date or due to improper storage after receipt are excluded.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

What is the shelf life of this product?

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.