Recombinant IGF2R Antibody

Catalog number RN-083-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-083-01

Size / count 50 μL

Specifications

Catalog number: RN-083-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Cation-independent mannose-6-phosphate receptor, CI Man-6-P receptor, CI-MPR, M6PR, 300 kDa mannose 6-phosphate receptor, MPR 300, Insulin-like growth factor 2 receptor, Insulin-like growth factor II receptor, IGF-II receptor, M6P/IGF2 receptor, M6P/IGF2R, CD antigen CD222
Gene Name: IGF2R
Gene ID: 3482
UniProt: P11717
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human IGF2R
Target Antigen: CD222
Target: PP-163
Partner Proteins: Cation-independent mannose-6-phosphate receptor; CI Man-6-P receptor; CI-MPR; M6PR; 300 kDa mannose 6-phosphate receptor; MPR 300; Insulin-like growth factor 2 receptor; Insulin-like growth factor II receptor; IGF-II receptor; M6P/IGF2 receptor; M6P/IGF2R; CD antigen CD222
Clone: K9N036_8A3
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 85%, Pig - 83%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: AVDGSQTETEKKHFFINICHRVLQEGKARGCPEDAAVCAVDKNGSKNLGKFISSPMKEKGNIQLSYSDGDDCGHGKKIKT
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 85%
Recombinant Antibody: Yes
IHC Dilution: 1:200~1:250
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: MPRI
Target Alternative Name: IGF2R
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: Insulin like growth factor 2 receptor
IHC description: Succeed
IP description: Fail (HeLa)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant IGF2R Antibody?

The catalog number for Recombinant IGF2R Antibody is RN-083.

What sizes are available for Recombinant IGF2R Antibody?

Recombinant IGF2R Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant IGF2R Antibody come in?

Recombinant IGF2R Antibody is available in 3 different pack sizes.

Is Recombinant IGF2R Antibody in stock?

Recombinant IGF2R Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.

Do you ship this product with dry ice?

Some products, including certain cell lines and biologics, require dry ice for transportation, which carries an additional fee shown clearly in your quotation. Dry ice delivery isn’t always possible to every destination due to transit time or local restrictions, so we check feasibility in advance and you must store the goods at the correct temperature the moment they arrive.

All Products