Recombinant NCR1 Antibody

Catalog number RN-089-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-089-01

Size / count 50 μL

Specifications

Catalog number: RN-089-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Natural cytotoxicity triggering receptor 1, Lymphocyte antigen 94 homolog, NK cell-activating receptor, Natural killer cell p46-related protein, NK-p46, NKp46, hNKp46, CD antigen CD335
Gene Name: NCR1
Gene ID: 9437
UniProt: O76036
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human NCR1
Target Antigen: CD335
Target: PP-3238
Partner Proteins: Natural cytotoxicity triggering receptor 1; Lymphocyte antigen 94 homolog; NK cell-activating receptor; Natural killer cell p46-related protein; NK-p46; NKp46; hNKp46; CD antigen CD335
Clone: K94064_6H6
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 57%, Rat - 61%, Pig - 61%, Cynomolgus monkey - 84%
Purity: ≥85%
Cores: IWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEM
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 57%
Recombinant Antibody: Yes
IHC Dilution: 1:500~1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: LY94
Target Alternative Name: NCR1
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: Natural cytotoxicity triggering receptor 1
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant NCR1 Antibody?

The catalog number for Recombinant NCR1 Antibody is RN-089.

What sizes are available for Recombinant NCR1 Antibody?

Recombinant NCR1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant NCR1 Antibody come in?

Recombinant NCR1 Antibody is available in 3 different pack sizes.

Is Recombinant NCR1 Antibody in stock?

Recombinant NCR1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.

All Products