Recombinant SORCS2 Antibody

Catalog number RN-085-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-085-01

Size / count 50 μL

Specifications

Catalog number: RN-085-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: VPS10 domain-containing receptor SorCS2 [Cleaved into: SorCS2 122 kDa chain, SorCS2 104 kDa chain, SorCS2 18 kDa chain]
Gene Name: SORCS2
Gene ID: 57537
UniProt: Q96PQ0
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SORCS2
Target: P02421PAD
Partner Proteins: VPS10 domain-containing receptor SorCS2 [Cleaved into: SorCS2 122 kDa chain; SorCS2 104 kDa chain; SorCS2 18 kDa chain]
Clone: K1E068_6E10
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 90%, Pig - 89%, Cynomolgus monkey - 97%
Purity: ≥85%
Cores: EGGVDMQQSQVQLQCPLTPPRGLQVSIQGEAVAVRPGEDVLFVVRQEQGDVLTTKYQVDLGDGFKAMYVNLTLTGEPIRHRYESPGIYRVSVRAENTAGHDEAVLFVQVNSPLQALYLEVVPVIGLNQEVNLTAVLLPLNPNLTVFYWWIGHSLQPLLSLDNSVTTRFSDTGDVRVTVQAACGNSVLQDSRVLRVLDQFQVMPLQFSKELDAYNPNTPEWREDVGLVVTRLLSKETSVPQELLVTVVKPGLPTLADLYVLLPPPRPTRKRSLSSDKRLAAIQQVLNAQKI
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 90%
Recombinant Antibody: Yes
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: KIAA1329
Target Alternative Name: SORCS2
Host or Source: Mouse
Protein Name: Sortilin related VPS10 domain containing receptor 2
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant SORCS2 Antibody?

The catalog number for Recombinant SORCS2 Antibody is RN-085.

What sizes are available for Recombinant SORCS2 Antibody?

Recombinant SORCS2 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant SORCS2 Antibody come in?

Recombinant SORCS2 Antibody is available in 3 different pack sizes.

Is Recombinant SORCS2 Antibody in stock?

Recombinant SORCS2 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

All Products