Recombinant ARSA Antibody

Catalog number RN-080-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-080-01

Size / count 50 μL

Specifications

Catalog number: RN-080-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Arylsulfatase A, ASA, Cerebroside-sulfatase) [Cleaved into: Arylsulfatase A component B, Arylsulfatase A component C]
Gene Name: ARSA
Gene ID: 410
UniProt: P15289
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ARSA
Target: P02142PAD
Partner Proteins: Arylsulfatase A; ASA; Cerebroside-sulfatase) [Cleaved into: Arylsulfatase A component B; Arylsulfatase A component C]
Clone: K29073_19C6
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 84%, Rat - 39%, Pig - 91%, Cynomolgus monkey - 97%
Purity: ≥85%
Cores: RSGRGPFGDSLMELDAAVGTLMTAIGDLGLLEETLVIFTADNGPETMRMSRGGCSGLLRCGKGTTYEGGVREPALAFWPGHIAPGVTHELASSLDLLPTLAALAGAPLPNVTLDGFDLSPLLLGTGKSPRQSLFFYPSYPDEVRGVFAVRTGKYKAHFFTQGSAHSDTTADPACHASSSLTAHEPPLLYDLSKDPGENYNLLGGVAGATPEVLQALKQLQLLKAQLDAAVTFGPSQVARG
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 84%
Recombinant Antibody: Yes
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: ARSA
Host or Source: Mouse
Protein Name: Arylsulfatase A
WB Description: Succeed
IP description: Fail (HeLa)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant ARSA Antibody?

The catalog number for Recombinant ARSA Antibody is RN-080.

What sizes are available for Recombinant ARSA Antibody?

Recombinant ARSA Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant ARSA Antibody come in?

Recombinant ARSA Antibody is available in 3 different pack sizes.

Is Recombinant ARSA Antibody in stock?

Recombinant ARSA Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

All Products