Recombinant TYMS Antibody

Catalog number RN-088-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-088-01

Size / count 50 μL

Specifications

Catalog number: RN-088-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Thymidylate synthase, TS, TSase
Gene Name: TYMS
Gene ID: 7298
UniProt: P04818
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human TYMS
Target: PP-4357
Partner Proteins: Thymidylate synthase; TS; TSase
Clone: K92084_12C4
Conjugation: Unconjugated
Applications: Top_IHC&Top_WB
Validation: Top_IHC&Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 89%, Rat - 88%, Pig - 94%, Cynomolgus monkey - 97%
Purity: ≥85%
Cores: MPVAGSELPRRPLPPAAQERDAEPRPPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 89%
Recombinant Antibody: Yes
IHC Dilution: 1:100~1:200
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: TS
Target Alternative Name: TYMS
Panel Description: IHC Pathology
Host or Source: Mouse
Protein Name: Thymidylate synthetase
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant TYMS Antibody?

The catalog number for Recombinant TYMS Antibody is RN-088.

What sizes are available for Recombinant TYMS Antibody?

Recombinant TYMS Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant TYMS Antibody come in?

Recombinant TYMS Antibody is available in 3 different pack sizes.

Is Recombinant TYMS Antibody in stock?

Recombinant TYMS Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.

Does this product need any special customs documentation to be imported to my country?

If you’re outside the EU, UK, or USA, you’re responsible for customs clearance and any related taxes or fees. We provide the standard import documents, such as the Commercial Invoice, Packing List, and Airway Bill, in advance, so let us know early if your customs office needs anything additional for this specific product.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.