Recombinant YY1 Antibody

Catalog number RN-086-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-086-01

Size / count 50 μL

Specifications

Catalog number: RN-086-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Transcriptional repressor protein YY1, Delta transcription factor, INO80 complex subunit S, NF-E1, Yin and yang 1, YY-1
Gene Name: YY1
Gene ID: 7528
UniProt: P25490
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human YY1
Target: PP-768
Partner Proteins: Transcriptional repressor protein YY1; Delta transcription factor; INO80 complex subunit S; NF-E1; Yin and yang 1; YY-1
Clone: K40091_9H7
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 99%, Rat - 57%, Pig - 97%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: RVKKGGGKKSGKKSYLSGGAGAAGGGGADPGNKKWEQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDN
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 99%
Recombinant Antibody: Yes
IHC Dilution: 1:100~1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: INO80S
Target Alternative Name: YY1
Panel Description: Ferroptosis, Transcription Factors
Host or Source: Mouse
Protein Name: YY1 transcription factor
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant YY1 Antibody?

The catalog number for Recombinant YY1 Antibody is RN-086.

What sizes are available for Recombinant YY1 Antibody?

Recombinant YY1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant YY1 Antibody come in?

Recombinant YY1 Antibody is available in 3 different pack sizes.

Is Recombinant YY1 Antibody in stock?

Recombinant YY1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

Is this product covered by a money-back guarantee?

Yes, we guarantee a full refund or store credit if this product arrives damaged beyond usability, or has a genuine performance issue under proper usage and storage, provided you report it immediately with evidence. Claims after the expiration date or due to improper storage after receipt are excluded.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

All Products