Recombinant RAB6B Antibody — image 1 of 2

Product details

Recombinant RAB6B Antibody

Catalog number RN-096-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-096-01

Size / count 50 μL

Specifications

Catalog number: RN-096-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Ras-related protein Rab-6B
Gene Name: RAB6B
Gene ID: 51560
UniProt: Q9NRW1
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human RAB6B
Target: PP-998
Partner Proteins: Ras-related protein Rab-6B
Clone: K16296_7H3
Conjugation: Unconjugated
Applications: Top_IHC&Top_IP/ChIP&Top_WB
Validation: Top_IHC&Top_IP/ChIP&Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 100%, Rat - 83%, Pig - 100%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: VRTERGSDVIIMLVGNKTDLADKRQITIEEGEQRAKELSVMFIETSAKTGYNVKQLFRRVASALPGMENVQEKSKEGMIDIKLDKPQEPP
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 100%
Recombinant Antibody: Yes
IHC Dilution: 1:500~1:1000
WB Dilution: 1:2000
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: RAB6B
Host or Source: Mouse
Protein Name: RAB6B, member RAS oncogene family
WB Description: Succeed
IHC description: Succeed
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant RAB6B Antibody?

The catalog number for Recombinant RAB6B Antibody is RN-096.

What sizes are available for Recombinant RAB6B Antibody?

Recombinant RAB6B Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant RAB6B Antibody come in?

Recombinant RAB6B Antibody is available in 3 different pack sizes.

Is Recombinant RAB6B Antibody in stock?

Recombinant RAB6B Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

All Products