Recombinant PRAP1 Antibody

Catalog number RC-3878-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-3878-01

Size / count 50 μL

Specifications

Catalog number: RC-3878-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Proline-rich acidic protein 1, Epididymis tissue protein Li 178, Uterine-specific proline-rich acidic protein
Gene Name: PRAP1
Gene ID: 118471
UniProt: Q96NZ9
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: /
Partner Proteins: Proline-rich acidic protein 1; Epididymis tissue protein Li 178; Uterine-specific proline-rich acidic protein
Clone: K03_1J08
Conjugation: Unconjugated
Applications: IHC
Validation: IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 44%, Rat - 48%, Pig - 41%, Cynomolgus monkey - 80%
Purity: ≥85%
Cores: VPAPKVPIKMQVKHWPSEQDPEKAWGARVVEPPEKDDQLVVLFPVQKPKLLTTEEKPRGQGRGPILPGTKAWMETEDTLGHVLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGPEEDQDHIYHPQ
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 44%
Recombinant Antibody: Yes
IHC Dilution: 1:2000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: UPA
Target Alternative Name: PRAP1
Host or Source: Rabbit
Protein Name: Proline rich acidic protein 1
WB Description: Fail (THP-1, HeLa, Liver)
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant PRAP1 Antibody?

The catalog number for Recombinant PRAP1 Antibody is RC-3878.

What sizes are available for Recombinant PRAP1 Antibody?

Recombinant PRAP1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant PRAP1 Antibody come in?

Recombinant PRAP1 Antibody is available in 3 different pack sizes.

Is Recombinant PRAP1 Antibody in stock?

Recombinant PRAP1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What should I do if I need to report a performance issue with a specific lot of this product?

Provide the catalogue number, product name, lot number, and your experimental results to our technical support team. They’ll investigate and, if needed, escalate to the manufacturer, provided the product was used before expiry and stored correctly.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

All Products