Recombinant DLK1 Antibody

Catalog number RC-3934-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-3934-01

Size / count 50 μL

Specifications

Catalog number: RC-3934-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Protein delta homolog 1, DLK-1, pG2) [Cleaved into: Fetal antigen 1, FA1]
Gene Name: DLK1
Gene ID: 8788
UniProt: P80370
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: /
Partner Proteins: Protein delta homolog 1; DLK-1; pG2) [Cleaved into: Fetal antigen 1; FA1]
Clone: K03_1J22
Conjugation: Unconjugated
Applications: WB&FC
Validation: WB&FC
Dilution: 1:100
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 82%, Rat - 82%, Pig - 82%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: AECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGEPGQCICTDGWDGELCDRDVRACSSAPCANNRTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQ
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 82%
Recombinant Antibody: Yes
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: DLK
Target Alternative Name: DLK1
Host or Source: Rabbit
Protein Name: Delta like non-canonical Notch ligand 1
WB Description: Succeed
IHC description: Fail (Pancreas)
IP description: Fail (Hep G2)
FC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant DLK1 Antibody?

The catalog number for Recombinant DLK1 Antibody is RC-3934.

What sizes are available for Recombinant DLK1 Antibody?

Recombinant DLK1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant DLK1 Antibody come in?

Recombinant DLK1 Antibody is available in 3 different pack sizes.

Is Recombinant DLK1 Antibody in stock?

Recombinant DLK1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the shelf life of this product?

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.

What expression system was used for this recombinant protein?

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.

Can I return this product if I ordered the wrong one?

As a consumer, you have a 14-day right of withdrawal from receipt under EU consumer protection law, submitted via our withdrawal/cancellation request form. Note this applies to unused, undamaged products, and doesn’t override the expiry/storage conditions on performance-based claims.

All Products