Recombinant LACRT Antibody

Catalog number RC-3893-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-3893-01

Size / count 50 μL

Specifications

Catalog number: RC-3893-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Extracellular glycoprotein lacritin
Gene Name: LACRT
Gene ID: 90070
UniProt: Q9GZZ8
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: /
Partner Proteins: Extracellular glycoprotein lacritin
Clone: K03_1J27
Conjugation: Unconjugated
Applications: IHC
Validation: IHC
Homology: Highest antigen sequence identity to the following orthologs: Cynomolgus monkey - 88%
Purity: ≥85%
Cores: EDASSDSTGADPAQEAGTSKPNEEISGPAEPASPPETTTTAQETSAAAVQGTAKVTSSRQELNPLKSIVEKSILLTEQALAKAGKGMHGGVPGGKQFIENGSEFAQKLLKKFSLLKPWA
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Recombinant Antibody: Yes
IHC Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: LACRT
Host or Source: Rabbit
Protein Name: Lacritin
WB Description: Fail (Mouse Heart, Mouse Thymus)
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant LACRT Antibody?

The catalog number for Recombinant LACRT Antibody is RC-3893.

What sizes are available for Recombinant LACRT Antibody?

Recombinant LACRT Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant LACRT Antibody come in?

Recombinant LACRT Antibody is available in 3 different pack sizes.

Is Recombinant LACRT Antibody in stock?

Recombinant LACRT Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.

Does this product need any special customs documentation to be imported to my country?

If you’re outside the EU, UK, or USA, you’re responsible for customs clearance and any related taxes or fees. We provide the standard import documents, such as the Commercial Invoice, Packing List, and Airway Bill, in advance, so let us know early if your customs office needs anything additional for this specific product.

All Products