Recombinant Trefoil Factor 2 Antibody

Catalog number RC-3849-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-3849-01

Size / count 50 μL

Specifications

Catalog number: RC-3849-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Trefoil factor 2, Spasmolysin, Spasmolytic polypeptide, SP
Gene Name: TFF2
Gene ID: 7032
UniProt: Q03403
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: /
Partner Proteins: Trefoil factor 2; Spasmolysin; Spasmolytic polypeptide; SP
Clone: K03_1J32
Conjugation: Unconjugated
Applications: IHC
Validation: IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 87%, Rat - 83%, Pig - 76%, Cynomolgus monkey - 87%
Purity: ≥85%
Cores: EKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 87%
Recombinant Antibody: Yes
IHC Dilution: 1:500~1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: SML1
Target Alternative Name: Trefoil Factor 2
Host or Source: Rabbit
Protein Name: Trefoil factor 2
WB Description: Fail (HT-29, HEK-293)
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant Trefoil Factor 2 Antibody?

The catalog number for Recombinant Trefoil Factor 2 Antibody is RC-3849.

What sizes are available for Recombinant Trefoil Factor 2 Antibody?

Recombinant Trefoil Factor 2 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant Trefoil Factor 2 Antibody come in?

Recombinant Trefoil Factor 2 Antibody is available in 3 different pack sizes.

Is Recombinant Trefoil Factor 2 Antibody in stock?

Recombinant Trefoil Factor 2 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

Is this product covered by a money-back guarantee?

Yes, we guarantee a full refund or store credit if this product arrives damaged beyond usability, or has a genuine performance issue under proper usage and storage, provided you report it immediately with evidence. Claims after the expiration date or due to improper storage after receipt are excluded.