Recombinant CGB1 Antibody

Catalog number RC-3736-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-3736-01

Size / count 50 μL

Specifications

Catalog number: RC-3736-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Choriogonadotropin subunit beta variant 1
Gene Name: CGB1
Gene ID: 114335
UniProt: A6NKQ9
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: /
Partner Proteins: Choriogonadotropin subunit beta variant 1
Clone: K03_1J44
Conjugation: Unconjugated
Applications: IHC
Validation: IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 64%, Rat - 64%, Pig - 66%, Cynomolgus monkey - 84%
Purity: ≥85%
Cores: SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGP
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 64%
Recombinant Antibody: Yes
IHC Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: CGB1
Host or Source: Rabbit
Protein Name: Choriogonadotropin subunit beta variant 1
WB Description: Fail (K-562,3T3)
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant CGB1 Antibody?

The catalog number for Recombinant CGB1 Antibody is RC-3736.

What sizes are available for Recombinant CGB1 Antibody?

Recombinant CGB1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant CGB1 Antibody come in?

Recombinant CGB1 Antibody is available in 3 different pack sizes.

Is Recombinant CGB1 Antibody in stock?

Recombinant CGB1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Does this cell line or biologic require a Material Transfer Agreement (MTA)?

Some products, including certain cell lines, plasmids, and tissue cultures, are subject to intellectual property terms and may require an MTA before we can ship. We’ll inform you in advance if this product requires one, and additional handling fees may apply.

What should I do if I need to report a performance issue with a specific lot of this product?

Provide the catalogue number, product name, lot number, and your experimental results to our technical support team. They’ll investigate and, if needed, escalate to the manufacturer, provided the product was used before expiry and stored correctly.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.