Recombinant KIR2DL1 Antibody — image 1 of 2

Product details

Recombinant KIR2DL1 Antibody

Catalog number RC-3788-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-3788-01

Size / count 50 μL

Specifications

Catalog number: RC-3788-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Killer cell immunoglobulin-like receptor 2DL1, CD158 antigen-like family member A, Natural killer-associated transcript 1, NKAT-1, p58 natural killer cell receptor clones CL-42/47.11, p58 NK receptor CL-42/47.11, p58.1 MHC class-I-specific NK receptor, CD antigen CD158a
Gene Name: KIR2DL1
Gene ID: 3802
UniProt: P43626
Antigen Species: Human
Reactivity: Human, Mouse
Cross Reactivity: Not tested
Immunogen: /
Target Antigen: CD158a
Partner Proteins: Killer cell immunoglobulin-like receptor 2DL1; CD158 antigen-like family member A; Natural killer-associated transcript 1; NKAT-1; p58 natural killer cell receptor clones CL-42/47.11; p58 NK receptor CL-42/47.11; p58.1 MHC class-I-specific NK receptor; CD antigen CD158a
Clone: K03_1J64
Conjugation: Unconjugated
Applications: IHC&WB
Validation: IHC&WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 40%, Rat - 37%, Pig - 50%, Cynomolgus monkey - 80%
Purity: ≥85%
Cores: HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNGTFQADFPLGPATHGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLHILIGTSVVIILFILLFFLLHRWCSNKKNAAVMDQESAGNRTANSEDSDEQDPQEVTYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAESRSKVVSCP
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 40%
Recombinant Antibody: Yes
IHC Dilution: 1:500~1:1000
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: CD158A; NKAT1
Target Alternative Name: KIR2DL1
Panel Description: CD Antigen
Host or Source: Rabbit
Protein Name: Killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 1
WB Description: Succeed
IHC description: Succeed
IP description: Fail (NIH/3T3)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant KIR2DL1 Antibody?

The catalog number for Recombinant KIR2DL1 Antibody is RC-3788.

What sizes are available for Recombinant KIR2DL1 Antibody?

Recombinant KIR2DL1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant KIR2DL1 Antibody come in?

Recombinant KIR2DL1 Antibody is available in 3 different pack sizes.

Is Recombinant KIR2DL1 Antibody in stock?

Recombinant KIR2DL1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.

Do you ship this product with dry ice?

Some products, including certain cell lines and biologics, require dry ice for transportation, which carries an additional fee shown clearly in your quotation. Dry ice delivery isn’t always possible to every destination due to transit time or local restrictions, so we check feasibility in advance and you must store the goods at the correct temperature the moment they arrive.

Is this product species cross-reactive?

Cross-reactivity data, based on available testing, is listed under the reactivity section of the datasheet. Contact us if you need reactivity confirmed for a species not listed.