Recombinant KIR3DL2 Antibody

Catalog number RC-3950-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-3950-01

Size / count 50 μL

Specifications

Catalog number: RC-3950-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Killer cell immunoglobulin-like receptor 3DL2, CD158 antigen-like family member K, Natural killer-associated transcript 4, NKAT-4, p70 natural killer cell receptor clone CL-5, p70 NK receptor CL-5, CD antigen CD158k
Gene Name: KIR3DL2
Gene ID: 3812
UniProt: P43630
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: /
Target Antigen: CD158k
Partner Proteins: Killer cell immunoglobulin-like receptor 3DL2; CD158 antigen-like family member K; Natural killer-associated transcript 4; NKAT-4; p70 natural killer cell receptor clone CL-5; p70 NK receptor CL-5; CD antigen CD158k
Clone: K03_1J73
Conjugation: Unconjugated
Applications: WB
Validation: WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 42%, Rat - 38%, Pig - 49%, Cynomolgus monkey - 78%
Purity: ≥85%
Cores: LMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFMLYKEDRSHVPIFHGRIFQESFIMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGNHRKPSLLAHPGPLLKSGETVILQCWSDVMFEHFFLHREGISEDPSRLVGQIHDGVSKANFSIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENVTLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADFPLGPATHGGTYRCFGSFRALPCVWSNSSDPLLVSVTGNPSSSWPSPTEPSSKSGICRHLHVLIGTSVVIFLFILLLFFLLYRWCSNKKNAAVMDQEPAGDRTVNRQDSDEQDPQEVTYAQLDHCVFIQRKISRPSQRPKTPLTDTSVYTELPNAEPRSKVVSCPRAPQSGLEGVF
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 42%
Recombinant Antibody: Yes
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: CD158K; NKAT4
Target Alternative Name: KIR3DL2
Panel Description: CD Antigen
Host or Source: Rabbit
Protein Name: Killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 2
WB Description: Succeed
IHC description: Fail (Brain)
IP description: Fail (SK-OV-3)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant KIR3DL2 Antibody?

The catalog number for Recombinant KIR3DL2 Antibody is RC-3950.

What sizes are available for Recombinant KIR3DL2 Antibody?

Recombinant KIR3DL2 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant KIR3DL2 Antibody come in?

Recombinant KIR3DL2 Antibody is available in 3 different pack sizes.

Is Recombinant KIR3DL2 Antibody in stock?

Recombinant KIR3DL2 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.