Recombinant CD1D Antibody — image 1 of 2

Product details

Recombinant CD1D Antibody

Catalog number RC-3798-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-3798-01

Size / count 50 μL

Specifications

Catalog number: RC-3798-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Antigen-presenting glycoprotein CD1d, R3G1, CD antigen CD1d
Gene Name: CD1D
Gene ID: 912
UniProt: P15813
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: /
Target Antigen: CD1d
Partner Proteins: Antigen-presenting glycoprotein CD1d; R3G1; CD antigen CD1d
Clone: K03_1J80
Conjugation: Unconjugated
Applications: IHC&WB
Validation: IHC&WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 61%, Rat - 65%, Pig - 68%, Cynomolgus monkey - 89%
Purity: ≥85%
Cores: EVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWGGSYTSMGLIALAVLACLLFLLIVGFTSRFKRQTSYQGVL
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 61%
Recombinant Antibody: Yes
IHC Dilution: 1:200
WB Dilution: 1:500
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: CD1D
Panel Description: CD Antigen
Host or Source: Rabbit
Protein Name: CD1d molecule
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant CD1D Antibody?

The catalog number for Recombinant CD1D Antibody is RC-3798.

What sizes are available for Recombinant CD1D Antibody?

Recombinant CD1D Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant CD1D Antibody come in?

Recombinant CD1D Antibody is available in 3 different pack sizes.

Is Recombinant CD1D Antibody in stock?

Recombinant CD1D Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.