Recombinant NTF4 Antibody

Catalog number RC-3828-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-3828-01

Size / count 50 μL

Specifications

Catalog number: RC-3828-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Neurotrophin-4, NT-4, Neurotrophin-5, NT-5, Neutrophic factor 4
Gene Name: NTF4
Gene ID: 4909
UniProt: P34130
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: /
Partner Proteins: Neurotrophin-4; NT-4; Neurotrophin-5; NT-5; Neutrophic factor 4
Clone: K03_1J87
Conjugation: Unconjugated
Applications: IHC
Validation: IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 95%, Rat - 95%, Pig - 97%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: GVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 95%
Recombinant Antibody: Yes
IHC Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: NTF5
Target Alternative Name: NTF4
Panel Description: Cytokines
Host or Source: Rabbit
Protein Name: Neurotrophin 4
WB Description: Fail (PC-3, SH-SY5Y)
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant NTF4 Antibody?

The catalog number for Recombinant NTF4 Antibody is RC-3828.

What sizes are available for Recombinant NTF4 Antibody?

Recombinant NTF4 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant NTF4 Antibody come in?

Recombinant NTF4 Antibody is available in 3 different pack sizes.

Is Recombinant NTF4 Antibody in stock?

Recombinant NTF4 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What should I check when this product first arrives?

Inspect the package immediately for transportation damage, ice loss, leakage, or breakage. Report any issues right away with photos and your order reference; our specialists will determine whether the product is still usable or needs replacing.

Does this cell line or biologic require a Material Transfer Agreement (MTA)?

Some products, including certain cell lines, plasmids, and tissue cultures, are subject to intellectual property terms and may require an MTA before we can ship. We’ll inform you in advance if this product requires one, and additional handling fees may apply.

What should I do if I need to report a performance issue with a specific lot of this product?

Provide the catalogue number, product name, lot number, and your experimental results to our technical support team. They’ll investigate and, if needed, escalate to the manufacturer, provided the product was used before expiry and stored correctly.