Recombinant IGFBP6 Antibody

Catalog number RC-3782-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-3782-01

Size / count 50 μL

Specifications

Catalog number: RC-3782-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Insulin-like growth factor-binding protein 6, IBP-6, IGF-binding protein 6, IGFBP-6
Gene Name: IGFBP6
Gene ID: 3489
UniProt: P24592
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: /
Partner Proteins: Insulin-like growth factor-binding protein 6; IBP-6; IGF-binding protein 6; IGFBP-6
Clone: K03_1J88
Conjugation: Unconjugated
Applications: IHC
Validation: IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 71%, Rat - 67%, Pig - 85%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: RCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 71%
Recombinant Antibody: Yes
IHC Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: IBP6
Target Alternative Name: IGFBP6
Panel Description: Ferroptosis
Host or Source: Rabbit
Protein Name: Insulin like growth factor binding protein 6
WB Description: Fail (K-562, Kidney)
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant IGFBP6 Antibody?

The catalog number for Recombinant IGFBP6 Antibody is RC-3782.

What sizes are available for Recombinant IGFBP6 Antibody?

Recombinant IGFBP6 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant IGFBP6 Antibody come in?

Recombinant IGFBP6 Antibody is available in 3 different pack sizes.

Is Recombinant IGFBP6 Antibody in stock?

Recombinant IGFBP6 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What happens if this product doesn’t perform as expected in my experiment?

Send us the catalogue number, product name, lot number, and a summary of your results. Our technical support team will investigate and, where needed, involve the manufacturer. This is covered under our guarantee provided the product was used before its expiry date and stored correctly.

Is this product classed as hazardous or restricted for shipping?

Some products are subject to special import/export regulations, dangerous goods handling, or licensing requirements. Where this applies, it’s noted on the product page, and any required extra documents or fees will be confirmed with you before dispatch, never added without your consent.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

All Products