Recombinant CGB2 Antibody — image 1 of 2

Product details

Recombinant CGB2 Antibody

Catalog number RC-3735-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-3735-01

Size / count 50 μL

Specifications

Catalog number: RC-3735-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Choriogonadotropin subunit beta variant 2
Gene Name: CGB2
Gene ID: 114336
UniProt: Q6NT52
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: /
Partner Proteins: Choriogonadotropin subunit beta variant 2
Clone: K03_1K25
Conjugation: Unconjugated
Applications: IHC&WB
Validation: IHC&WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 64%, Rat - 64%, Pig - 66%, Cynomolgus monkey - 83%
Purity: ≥85%
Cores: SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQASSSSKAPPPSLPSPSRLPGPSDTPILPQ
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 64%
Recombinant Antibody: Yes
IHC Dilution: 1:250~1:500
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: CGB2
Host or Source: Rabbit
Protein Name: Choriogonadotropin subunit beta variant 2
WB Description: Succeed
IHC description: Succeed
IP description: Fail (HEC-1-B)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant CGB2 Antibody?

The catalog number for Recombinant CGB2 Antibody is RC-3735.

What sizes are available for Recombinant CGB2 Antibody?

Recombinant CGB2 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant CGB2 Antibody come in?

Recombinant CGB2 Antibody is available in 3 different pack sizes.

Is Recombinant CGB2 Antibody in stock?

Recombinant CGB2 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is there an additional fee for hazardous or dry ice shipping of this product?

Yes, if this product requires dry ice or is classed as hazardous for transport, the additional fee will be explicitly shown in your quotation before you confirm the order, so there are no surprise charges later.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

All Products