Recombinant IFNA21 Antibody

Catalog number RC-3897-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-3897-01

Size / count 50 μL

Specifications

Catalog number: RC-3897-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Interferon alpha-21, IFN-alpha-21, Interferon alpha-F, LeIF F
Gene Name: IFNA21
Gene ID: 3452
UniProt: P01568
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: /
Partner Proteins: Interferon alpha-21; IFN-alpha-21; Interferon alpha-F; LeIF F
Clone: K03_1K43
Conjugation: Unconjugated
Applications: IHC
Validation: IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 62%, Rat - 59%, Pig - 70%, Cynomolgus monkey - 89%
Purity: ≥85%
Cores: CDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWEQSLLEKFSTELNQQLNDLEACVIQEVGVEETPLMNVDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKIFQERLRRKE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 62%
Recombinant Antibody: Yes
IHC Dilution: 1:2000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: IFNA21
Panel Description: Cytokines, Ferroptosis
Host or Source: Rabbit
Protein Name: Interferon alpha 21
WB Description: Fail (NIH/3T3, Hep G2)
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant IFNA21 Antibody?

The catalog number for Recombinant IFNA21 Antibody is RC-3897.

What sizes are available for Recombinant IFNA21 Antibody?

Recombinant IFNA21 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant IFNA21 Antibody come in?

Recombinant IFNA21 Antibody is available in 3 different pack sizes.

Is Recombinant IFNA21 Antibody in stock?

Recombinant IFNA21 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

All Products