Recombinant CST1 Antibody

Catalog number RC-7123-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-7123-01

Size / count 50 μL

Specifications

Catalog number: RC-7123-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Cystatin-SN, Cystain-SA-I, Cystatin-1, Salivary cystatin-SA-1
Gene Name: CST1
Gene ID: 1469
UniProt: P01037
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: /
Partner Proteins: Cystatin-SN; Cystain-SA-I; Cystatin-1; Salivary cystatin-SA-1
Clone: K03_1K50
Conjugation: Unconjugated
Applications: IHC
Validation: IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 55%, Rat - 55%, Pig - 61%, Cynomolgus monkey - 83%
Purity: ≥85%
Cores: WSPKEEDRIIPGGIYNADLNDEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQES
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 55%
Recombinant Antibody: Yes
IHC Dilution: 1:2000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: CST1
Panel Description: Ferroptosis
Host or Source: Rabbit
Protein Name: Cystatin SN
WB Description: Fail (Jurkat, THP-1, A-431)
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant CST1 Antibody?

The catalog number for Recombinant CST1 Antibody is RC-7123.

What sizes are available for Recombinant CST1 Antibody?

Recombinant CST1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant CST1 Antibody come in?

Recombinant CST1 Antibody is available in 3 different pack sizes.

Is Recombinant CST1 Antibody in stock?

Recombinant CST1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

All Products