Recombinant Ace Antibody

Catalog number RC-4474-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-4474-01

Size / count 50 μL

Specifications

Catalog number: RC-4474-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Angiotensin-converting enzyme, ACE, Dipeptidyl carboxypeptidase I, Kininase II, CD antigen CD143) [Cleaved into: Angiotensin-converting enzyme, soluble form]
Gene Name: Ace
UniProt: P09470
Antigen Species: Mouse
Reactivity: Mouse, Rat
Cross Reactivity: Not tested
Immunogen: Recombinant protein of mouse Angiotensin Converting Enzyme 1
Target Antigen: CD143
Partner Proteins: Angiotensin-converting enzyme; ACE; Dipeptidyl carboxypeptidase I; Kininase II; CD antigen CD143) [Cleaved into: Angiotensin-converting enzyme; soluble form]
Clone: K01_1M75
Conjugation: Unconjugated
Applications: WB
Validation: WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 100%, Rat - 94%, Pig - 81%, Cynomolgus monkey - 82%
Purity: ≥85%
Cores: PLPDNYPEGIDLETDEAKADRFVEEYDRTAQVLLNEYAEANWQYNTNITIEGSKILLEKSTEVSNHTLKYGTRAKTFDVSNFQNSSIKRIIKKLQNLDRAVLPPKELEEYNQILLDMETTYSLSNICYTNGTCMPLEPDLTNMMATSRKYEELLWAWKSWRDKVGRAILPFFPKYVEFSNKIAKLNGYTDAGDSWRSLYESDNLEQDLEKLYQELQPLYLNLHAYVRRSLHRHYGSEYINLDGPIPAHLLGNMWAQTWSNIYDLVAPFPSAPNIDATEAMIKQGWTPRRIFKEADNFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHPSAWDFYNGKDFRIKQCTSVNMEDLVIAHHEMGHIQYFMQYKDLPVTFREGANPGFHEAIGDIMALSVSTPKHLYSLNLLSTEGSGYEYDINFLMKMALDKIAFIPFSYLIDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVPRSQGDFDPGSKFHVPANVPYVRYFVSFIIQFQFHEALCRAAGHTGPLHKCDIYQSKEAGKLLADAMKLGYSKPWPEAMKLITGQPNMSASAMMNYFKPLTEWLVTENRRHGETLGWPEYNWAPNTAR
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 100%
Recombinant Antibody: Yes
WB Dilution: 1:500~1:1000
Formulation: 50mM Tris-Glycine (pH 7.4),0.15M NaCl,40% Glycerol,0.01% Sodium azide and 0.05% BSA
Antibody Type: Monoclonal
Gene Name Synonym: Dcp1
Target Alternative Name: Ace
Panel Description: CD Antigen
Host or Source: Rabbit
Protein Name: Angiotensin-converting enzyme
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant Ace Antibody?

The catalog number for Recombinant Ace Antibody is RC-4474.

What sizes are available for Recombinant Ace Antibody?

Recombinant Ace Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant Ace Antibody come in?

Recombinant Ace Antibody is available in 3 different pack sizes.

Is Recombinant Ace Antibody in stock?

Recombinant Ace Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product tested for endotoxin levels?

Endotoxin testing status is noted on the datasheet where applicable, particularly for recombinant proteins intended for cell-based or functional assays. If this isn’t listed and you need confirmation, contact support with the catalogue number.

Can I request additional validation data, such as western blot images, for this product?

Additional data may be available on request. Contact our technical support team with the catalogue number and we’ll check what supporting documentation the supplier can provide.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.