Recombinant AKT1/AKT2/AKT3 Antibody — image 1 of 3

Product details

Recombinant AKT1/AKT2/AKT3 Antibody

Catalog number RC-6365-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-6365-01

Size / count 50 μL

Specifications

Catalog number: RC-6365-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Gene Name: AKT1/AKT2/AKT3
Gene ID: 207,208,10000
UniProt: P31749/P31751/Q9Y243
Antigen Species: Human
Reactivity: Human, Mouse, Hamster, Rat
Cross Reactivity: Not tested
Immunogen: Recombinant protein of human AKT1/2/3
Partner Proteins: /
Clone: K01_2U04
Conjugation: Unconjugated
Applications: IHC&WB
Validation: IHC&WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 98%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: MLDKDGHIKITDFGLCKEGIKDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 99%
Recombinant Antibody: Yes
IHC Dilution: 1:1600
WB Dilution: 1:1000
Formulation: 50mM Tris-Glycine (pH 7.4),0.15M NaCl,40% Glycerol,0.01% Sodium azide and 0.05% BSA
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: AKT1/AKT2/AKT3
Host or Source: Rabbit
Protein Name: AKT serine/threonine kinase 1 etc.
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant AKT1/AKT2/AKT3 Antibody?

The catalog number for Recombinant AKT1/AKT2/AKT3 Antibody is RC-6365.

What sizes are available for Recombinant AKT1/AKT2/AKT3 Antibody?

Recombinant AKT1/AKT2/AKT3 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant AKT1/AKT2/AKT3 Antibody come in?

Recombinant AKT1/AKT2/AKT3 Antibody is available in 3 different pack sizes.

Is Recombinant AKT1/AKT2/AKT3 Antibody in stock?

Recombinant AKT1/AKT2/AKT3 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.

All Products