Recombinant Tgfb1 Antibody — image 1 of 3

Product details

Recombinant Tgfb1 Antibody

Catalog number RC-3063-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-3063-01

Size / count 50 μL

Specifications

Catalog number: RC-3063-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Transforming growth factor beta-1 proprotein [Cleaved into: Latency-associated peptide, LAP) ; Transforming growth factor beta-1, TGF-beta-1]
Gene Name: TGFB1
UniProt: P04202
Antigen Species: Mouse
Reactivity: Human, Mouse, Rat
Cross Reactivity: Not tested
Immunogen: Recombinant protein of mouse TGF beta 1
Partner Proteins: Transforming growth factor beta-1 proprotein [Cleaved into: Latency-associated peptide; LAP) ; Transforming growth factor beta-1; TGF-beta-1]
Clone: K01_1L37
Conjugation: Unconjugated
Applications: IHC&WB
Validation: IHC&WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 99%, Cynomolgus monkey - 85%
Purity: ≥85%
Cores: ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 100%
Recombinant Antibody: Yes
IHC Dilution: 1:500
WB Dilution: 1:750
Formulation: 50mM Tris-Glycine (pH 7.4),0.15M NaCl,40% Glycerol,0.01% Sodium azide and 0.05% BSA
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Tgfb1
Panel Description: Neuroscience Biomarkers
Host or Source: Rabbit
Protein Name: Transforming growth factor beta-1 proprotein
WB Description: Succeed
IHC description: Succeed
IP description: Fail (Jurkat)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant Tgfb1 Antibody?

The catalog number for Recombinant Tgfb1 Antibody is RC-3063.

What sizes are available for Recombinant Tgfb1 Antibody?

Recombinant Tgfb1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant Tgfb1 Antibody come in?

Recombinant Tgfb1 Antibody is available in 3 different pack sizes.

Is Recombinant Tgfb1 Antibody in stock?

Recombinant Tgfb1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can this product be used for co-immunoprecipitation (Co-IP)?

Suitability for Co-IP depends on the specific antibody and is noted under validated applications on the datasheet. If it isn’t listed, contact our technical support team for guidance based on your target and sample type.

Is this kit compatible with automated liquid handling platforms?

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

All Products