Recombinant CD66b Antibody

Catalog number RC-8444-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-8444-01

Size / count 50 μL

Specifications

Catalog number: RC-8444-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Carcinoembryonic antigen-related cell adhesion molecule 8, CD67 antigen, Carcinoembryonic antigen CGM6, Non-specific cross-reacting antigen NCA-95, CD antigen CD66b
Gene Name: CEACAM8
Gene ID: 1088
UniProt: P31997
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: /
Target Antigen: CD66b
Partner Proteins: Carcinoembryonic antigen-related cell adhesion molecule 8; CD67 antigen; Carcinoembryonic antigen CGM6; Non-specific cross-reacting antigen NCA-95; CD antigen CD66b
Clone: K03_1J35
Conjugation: Unconjugated
Applications: IHC
Validation: IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 54%, Rat - 54%, Pig - 52%, Cynomolgus monkey - 89%
Purity: ≥85%
Cores: QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSD
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 54%
Recombinant Antibody: Yes
IHC Dilution: 1:5000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: CGM6
Target Alternative Name: CD66b
Panel Description: CD Antigen
Host or Source: Rabbit
Protein Name: CEA cell adhesion molecule 8
WB Description: Fail (MCF7, NIH/3T3)
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant CD66b Antibody?

The catalog number for Recombinant CD66b Antibody is RC-8444.

What sizes are available for Recombinant CD66b Antibody?

Recombinant CD66b Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant CD66b Antibody come in?

Recombinant CD66b Antibody is available in 3 different pack sizes.

Is Recombinant CD66b Antibody in stock?

Recombinant CD66b Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

Can this product be used for co-immunoprecipitation (Co-IP)?

Suitability for Co-IP depends on the specific antibody and is noted under validated applications on the datasheet. If it isn’t listed, contact our technical support team for guidance based on your target and sample type.

All Products