Integrin beta-2 Antibody

Catalog number KC-30503-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-30503-01

Size / count 50 μL

Specifications

Catalog number: KC-30503-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Integrin beta-2, Cell surface adhesion glycoproteins LFA-1/CR3/p150, 95 subunit beta, Complement receptor C3 subunit beta, CD antigen CD18
Gene Name: ITGB2
Gene ID: 3689
UniProt: P05107
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ITGB2
Target Antigen: CD18
Target: PP-090
Partner Proteins: Integrin beta-2; Cell surface adhesion glycoproteins LFA-1/CR3/p150; 95 subunit beta; Complement receptor C3 subunit beta; CD antigen CD18
Clone: K16317_8C11
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 81%, Rat - 53%, Pig - 81%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: DQSRDRSLCHGKGFLECGICRCDTGYIGKNCECQTQGRSSQELEGSCRKDNNSIICSGLGDCVCGQCLCH
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 81%
Recombinant Antibody: Not recombinant
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: CD18; MFI7
Target Alternative Name: Integrin beta-2
Panel Description: CD Antigen
Host or Source: Mouse
Protein Name: Integrin subunit beta 2
WB Description: Succeed
IP description: Fail (U-937)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Integrin beta-2 Antibody?

The catalog number for Integrin beta-2 Antibody is KC-30503.

What sizes are available for Integrin beta-2 Antibody?

Integrin beta-2 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Integrin beta-2 Antibody come in?

Integrin beta-2 Antibody is available in 3 different pack sizes.

Is Integrin beta-2 Antibody in stock?

Integrin beta-2 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

What is the shelf life of this product?

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.

What expression system was used for this recombinant protein?

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.

All Products