Product details

Alpha Fodrin Antibody

Catalog number KC-30505-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-30505-01

Size / count 50 μL

Specifications

Catalog number: KC-30505-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Spectrin alpha chain, non-erythrocytic 1, Alpha-II spectrin, Fodrin alpha chain, Spectrin, non-erythroid alpha subunit
Gene Name: SPTAN1
Gene ID: 6709
UniProt: Q13813
Antigen Species: Human
Reactivity: Human, Mouse
Cross Reactivity: Not tested
Immunogen: Recombinant human SPTAN1
Target: PP-5039
Partner Proteins: Spectrin alpha chain; non-erythrocytic 1; Alpha-II spectrin; Fodrin alpha chain; Spectrin; non-erythroid alpha subunit
Clone: K92088_4D3
Conjugation: Unconjugated
Applications: Top_IHC&Top_WB
Validation: Top_IHC&Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 98%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: TAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETIRTRLMELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDMAAHEERVNEVNQFAAKLIQEQHPEEELIKTKQDEVNAAWQRLKGLALQRQGK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 99%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:2000
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: NEAS; SPTA2
Target Alternative Name: Alpha Fodrin
Panel Description: Autoimmune Disease, Neuroscience Biomarkers
Host or Source: Mouse
Protein Name: Spectrin alpha, non-erythrocytic 1
WB Description: Succeed
IHC description: Succeed
IP description: Fail (Mouse Brain)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Alpha Fodrin Antibody?

The catalog number for Alpha Fodrin Antibody is KC-30505.

What sizes are available for Alpha Fodrin Antibody?

Alpha Fodrin Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Alpha Fodrin Antibody come in?

Alpha Fodrin Antibody is available in 3 different pack sizes.

Is Alpha Fodrin Antibody in stock?

Alpha Fodrin Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

All Products