Glutamate Receptor 1 Antibody

Catalog number KC-31979-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-31979-01

Size / count 50 μL

Specifications

Catalog number: KC-31979-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Glutamate receptor 1, GluR-1, AMPA-selective glutamate receptor 1, GluR-A, GluR-K1, Glutamate receptor ionotropic, AMPA 1, GluA1
Gene Name: GRIA1
Gene ID: 2890
UniProt: P42261
Antigen Species: Human
Reactivity: Human, Mouse
Cross Reactivity: Not tested
Immunogen: Recombinant human GRIA1
Target: PP-290
Partner Proteins: Glutamate receptor 1; GluR-1; AMPA-selective glutamate receptor 1; GluR-A; GluR-K1; Glutamate receptor ionotropic; AMPA 1; GluA1
Clone: K9N047_1H5
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 100%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: AATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 100%
Recombinant Antibody: Not recombinant
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: GLUA1; GLUH1; GLUR1
Target Alternative Name: Glutamate Receptor 1
Panel Description: Autoimmune Disease
Host or Source: Mouse
Protein Name: Glutamate ionotropic receptor AMPA type subunit 1
WB Description: Succeed
IHC description: Fail (Brain, Mouse Brain)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Glutamate Receptor 1 Antibody?

The catalog number for Glutamate Receptor 1 Antibody is KC-31979.

What sizes are available for Glutamate Receptor 1 Antibody?

Glutamate Receptor 1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Glutamate Receptor 1 Antibody come in?

Glutamate Receptor 1 Antibody is available in 3 different pack sizes.

Is Glutamate Receptor 1 Antibody in stock?

Glutamate Receptor 1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What happens if this product doesn’t perform as expected in my experiment?

Send us the catalogue number, product name, lot number, and a summary of your results. Our technical support team will investigate and, where needed, involve the manufacturer. This is covered under our guarantee provided the product was used before its expiry date and stored correctly.

Is this product classed as hazardous or restricted for shipping?

Some products are subject to special import/export regulations, dangerous goods handling, or licensing requirements. Where this applies, it’s noted on the product page, and any required extra documents or fees will be confirmed with you before dispatch, never added without your consent.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

All Products